PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_8B52D54FD.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 238aa    MW: 27342.2 Da    PI: 8.566
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_8B52D54FD.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.2e-171057148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           +g+WT++Ed++lv+ v+++G ++W+ +a+  g++Rt+k+c++rw +yl
  Traes_4AL_8B52D54FD.2 10 KGPWTEQEDLQLVCTVRLFGDHRWDFVAKVSGLNRTGKSCRLRWVNYL 57
                           79********************************************97 PP

2Myb_DNA-binding55.21.6e-1764108248
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            gr++++E+ l++++++++G++ W++Iar+++ gRt++++k++w++++
  Traes_4AL_8B52D54FD.2  64 GRMSPQEEHLIIELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 108
                            89*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.087557IPR017930Myb domain
SuperFamilySSF466895.62E-298104IPR009057Homeodomain-like
SMARTSM007172.6E-14959IPR001005SANT/Myb domain
PfamPF002496.3E-161057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-191164IPR009057Homeodomain-like
CDDcd001677.34E-111257No hitNo description
PROSITE profilePS5129425.81258112IPR017930Myb domain
SMARTSM007174.3E-1562110IPR001005SANT/Myb domain
PfamPF002496.5E-1664107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-2465111IPR009057Homeodomain-like
CDDcd001672.44E-1165108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MVTVQDEMRK GPWTEQEDLQ LVCTVRLFGD HRWDFVAKVS GLNRTGKSCR LRWVNYLHPG  60
LKHGRMSPQE EHLIIELHAR WGNRWSRIAR RLPGRTDNEI KNYWRTHMRK KAQERKIDMS  120
PSSSSSSFTY QSCLLETAPI IRMDGGSTHN GTTCFSSVLK SNQSVMDGYS MDQIWKEIEA  180
PAMLPIDDKA CSNLPCPLLP SPMGDRYCPP EVVWKMDNGD LKMLAPQFGY GNGERSCY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-2771121105MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3672180.0AK367218.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2053B03.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015617959.11e-132PREDICTED: myb-related protein MYBAS1
SwissprotQ53NK61e-134MYBA1_ORYSJ; Myb-related protein MYBAS1
TrEMBLW5DR700.0W5DR70_WHEAT; Uncharacterized protein
STRINGLOC_Os11g47460.11e-131(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP63637169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59780.39e-73myb domain protein 59
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]